PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g36210.1.p
Common NameBRADI_4g36210, LOC100826598
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 275aa    MW: 29920.5 Da    PI: 5.6372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g36210.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-131464148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd++l   + + G g   +W++++++ g+ R++k+c++rw +yl
  Bradi4g36210.1.p 14 RGPWTAEEDKKLMGFILRSGAGgrcCWRAVPKMAGLLRCGKSCRLRWTNYL 64
                      89*********************************99************97 PP

2Myb_DNA-binding538e-1773114447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        T +E++l vd+++ lG++ W++Ia++++ gRt++++k++w+++
  Bradi4g36210.1.p  73 LTHDEEQLVVDLHASLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 114
                       699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-19566IPR009057Homeodomain-like
PROSITE profilePS5009010.035964IPR017877Myb-like domain
SuperFamilySSF466897.11E-2511111IPR009057Homeodomain-like
SMARTSM007179.8E-91366IPR001005SANT/Myb domain
PfamPF002491.6E-121464IPR001005SANT/Myb domain
CDDcd001678.70E-61664No hitNo description
PROSITE profilePS5129427.44465119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2467120IPR009057Homeodomain-like
SMARTSM007172.4E-1469117IPR001005SANT/Myb domain
PfamPF002491.8E-1473114IPR001005SANT/Myb domain
CDDcd001674.01E-1174115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRQPCCDKL GVKRGPWTAE EDKKLMGFIL RSGAGGRCCW RAVPKMAGLL RCGKSCRLRW  60
TNYLRPDLKR GLLTHDEEQL VVDLHASLGN RWSKIAAKLP GRTDNEIKNH WNTHIKKKLI  120
KMGIDPVTHQ PLHGRRKQQE EEEQATTTSA QSSTVSSSDK VMDVTSAGGE ASLPESSSTN  180
TSSTTTNGGG SHDQDPLVKW LLEEDDDLPT GGGIGEKWLD FTAGDDVDDL GSIAATMPWD  240
VGATDWLLDY QDFGVGDSSL LSMSMVDSSN GSNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26141197108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1060391e-133AK106039.1 Oryza sativa Japonica Group cDNA clone:001-206-D11, full insert sequence.
GenBankAK1117401e-133AK111740.1 Oryza sativa Japonica Group cDNA clone:J023047I22, full insert sequence.
GenBankAK1210231e-133AK121023.1 Oryza sativa Japonica Group cDNA clone:J023049M10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578505.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX64e-86ODO1_PETHY; Protein ODORANT1
TrEMBLI1IS710.0I1IS71_BRADI; Uncharacterized protein
STRINGBRADI4G36210.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.12e-81myb domain protein 85